PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G169300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 294aa    MW: 33522.4 Da    PI: 4.6483
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G169300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.74.1e-161663148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       rg+WT+ Ed++l+ +v++ G  +W++ +   g+ R++k+c++rw +yl
  Aqcoe1G169300.1.p 16 RGPWTPAEDKRLISYVEKNGHANWRALPTQAGLLRCGKSCRLRWINYL 63
                       89******************************99************97 PP

2Myb_DNA-binding54.92e-1769114148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rg++++eE+e ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  Aqcoe1G169300.1.p  69 RGNFSQEEEETIIRLHESLGNK-WSKIASHLP-GRTDNEIKNVWNTHL 114
                        89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.461163IPR017930Myb domain
SuperFamilySSF466896.97E-3013110IPR009057Homeodomain-like
SMARTSM007171.7E-111565IPR001005SANT/Myb domain
PfamPF002495.9E-151663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-241770IPR009057Homeodomain-like
CDDcd001674.42E-81863No hitNo description
PROSITE profilePS5129426.28864118IPR017930Myb domain
SMARTSM007171.0E-1568116IPR001005SANT/Myb domain
PfamPF002494.2E-1669114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2771117IPR009057Homeodomain-like
CDDcd001675.24E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRVRAPCCD KIGLKRGPWT PAEDKRLISY VEKNGHANWR ALPTQAGLLR CGKSCRLRWI  60
NYLRPDIKRG NFSQEEEETI IRLHESLGNK WSKIASHLPG RTDNEIKNVW NTHLKKRVAP  120
KGPKVCENET KEPSISSTSS DSSSSSANSS ISYCRSNTAD KEPQEPSDPM FSEEVRKEDS  180
FDGLEINMDL LEIPFEMDFL DMFEDKSCLN SNASSMCETD SQHTTVFEEE SKSEEEMRWM  240
AYLENELGLY DTCHVNQEIL ARDGTLQQET ASSNNEIMWP EFDLDPVAVY FQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261411825128MYB TRANSFORMING PROTEIN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00144DAPTransfer from AT1G16490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010247284.12e-85PREDICTED: transcription factor MYB3-like
STRINGVIT_19s0085g00050.t011e-76(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G16490.11e-72myb domain protein 58